Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMSB4X/Thymosin beta 4, Human (His)

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X/Thymosin beta 4 Protein, Human (His) is the recombinant human-derived TMSB4X protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TMSB4X/Thymosin beta 4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmsb4x-protein-human-his.html

Purity

95.0

Smiles

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Formula

7114 (Gene_ID) P62328 (S2-S44) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF488A conjugate, 0.1mg/mL
BNC881101-500 1x 500 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details