Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMSB4X/Thymosin beta 4, Human (His)

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. TMSB4X/Thymosin beta 4 Protein, Human (His) is the recombinant human-derived TMSB4X protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TMSB4X/Thymosin beta 4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tmsb4x-protein-human-his.html

Purity

95.0

Smiles

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Formula

7114 (Gene_ID) P62328 (S2-S44) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINGO2 Protein Lysate (Human) with C-Ha Tag
26864031 100 µg

LINGO2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PI3KC3 (S676) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 490) discontinued
039981-ML490 100 µL

PI3KC3 (S676) (Phosphatidylinositol 3-kinase catalytic subunit type 3, PtdIns-3-kinase type 3, PI3-kinase type 3, PI3K type 3, Phosphoinositide-3-kinase class 3, Phosphatidylinositol 3-kinase p100 subunit, vps34) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Nomega, Nomega'-Di-Z-L-arginine
sc-295940A 1 g

Nomega, Nomega'-Di-Z-L-arginine

Sign In for Pricing
View Details
CALmL6 (NM_138705) Human Tagged ORF Clone
RC222115 10 µg

CALmL6 (NM_138705) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Sphingosine-1-phosphate Antibody (Expression DD patent anti-SIP)
F1777-50 50 mg

Anti-Sphingosine-1-phosphate Antibody (Expression DD patent anti-SIP)

Sign In for Pricing
View Details
DPYS antibody
70R-1173 100 µL

DPYS antibody

Sign In for Pricing
View Details