Recombinant Crotalus atrox Snake venom serine protease catroxase-2
Product Specifications
Product Name Alternative
Catroxase II Kallikrein-like EI
Abbreviation
Recombinant Crotalus atrox Snake venom serine protease catroxase-2 protein
UniProt
Q8QHK2
Expression Region
25-258aa
Organism
Crotalus atrox (Western diamondback rattlesnake)
Target Sequence
VVGGDECNINEHRSLVAIFNSTEFFCSGTLINQEWVVTAAHCDSTNFKMKLGVHSKKVPNEDEQTRNPKEKFFCPNKKKDDVLDKDIMLIKLDSPVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEKTLPDVPYCANIKLLDDAVCQPPYPELPATSRTLCAGIPEGGKDTCGGDSGGPLICNGQFQGIVFYGAHPCGQALKPGVYTKVFDYNDWIQSIIAGNTAATCPP
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
Yeast
Field of Research
Others
Relevance
Snake venom serine protease that may act in the hemostasis system of the prey.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
27.2 kDa
References & Citations
"Exploring the venom proteome of the western diamondback rattlesnake, Crotalus atrox, via snake venomics and combinatorial peptide ligand library approaches." Calvete J.J., Fasoli E., Sanz L., Boschetti E., Righetti P.G. J. Proteome Res. 8:3055-3067 (2009)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680029-500 1x 500 µL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740040-100 1x 100 µL
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402713-500 1x 500 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881950-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details