Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSAD, Mouse (His-SUMO)

CSAD proteins play a crucial role in the metabolism of sulfur-containing amino acids, catalyzing L-aspartate, 3-sulfinyl-L-alanine (cysteine sulfenic acid) and L-cysteine The acid is decarboxylated to produce β-alanine, hypotaurine and taurine respectively. Among these substrates, 3-sulfinyl-L-alanine is the preferred substrate for CSAD. CSAD Protein, Mouse (His-SUMO) is the recombinant mouse-derived CSAD protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CSAD Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csad-protein-mouse-his-sumo.html

Purity

90.0

Smiles

MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL

Molecular Formula

246277 (Gene_ID) Q9DBE0 (M1-L493) (Accession)

Molecular Weight

Approximately 66 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSA (NM_001085425) Human Recombinant Protein
TP313072M 100 µg

ARSA (NM_001085425) Human Recombinant Protein

Sign In for Pricing
View Details
Miz1 (ZBTB17) Rabbit Polyclonal Antibody
TA383433 100 µL

Miz1 (ZBTB17) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Leucine-1-13C
TRC-L330625-100MG 100 mg

L-Leucine-1-13C

Sign In for Pricing
View Details
gamma-Polyglutamic Acid Sodium Salt (Technical Grade)
TRC-P689445-5G 5 g

gamma-Polyglutamic Acid Sodium Salt (Technical Grade)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF488A conjugate, 0.1mg/mL
BNC881729-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat IL-17A Protein (Trx Tag)
PDER100243-01 20 µg

Recombinant Rat IL-17A Protein (Trx Tag)

Sign In for Pricing
View Details