Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteocrin, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Osteocrin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osteocrin-protein-human-his.html

Purity

98.0

Smiles

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Molecular Formula

344901 (Gene_ID) P61366 (V28-G133) (Accession)

Molecular Weight

Approximately 12.0-13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Antibody
KC-154-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-154-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-154-03 1 mL

CDX2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561305 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Dynamin 3 (DNM3) (NM_015569) Human Recombinant Protein
TP324326L 1 mg

Dynamin 3 (DNM3) (NM_015569) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121M-01 50 Tests

Elab Fluor® 647 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details