Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteocrin, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Osteocrin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osteocrin-protein-human-his.html

Purity

98.0

Smiles

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Molecular Formula

344901 (Gene_ID) P61366 (V28-G133) (Accession)

Molecular Weight

Approximately 12.0-13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  40nm
GAF-451-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 40nm

Sign In for Pricing
View Details
IGSF3 Antibody
KC-31175-01 50 μL

IGSF3 Antibody

Sign In for Pricing
View Details
IGSF3 Antibody
KC-31175-02 100 µL

IGSF3 Antibody

Sign In for Pricing
View Details
IGSF3 Antibody
KC-31175-03 1 mL

IGSF3 Antibody

Sign In for Pricing
View Details
Human C19orf52 (TIMM29) activation kit by CRISPRa
GA114037 1 Kit

Human C19orf52 (TIMM29) activation kit by CRISPRa

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), Biotin conjugate, 0.1mg/mL
BNCB1880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details