Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteocrin, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Osteocrin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osteocrin-protein-human-his.html

Purity

98.0

Smiles

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Molecular Formula

344901 (Gene_ID) P61366 (V28-G133) (Accession)

Molecular Weight

Approximately 12.0-13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP94 Antibody: APC
SPC-101D-APC 100 µg

GRP94 Antibody: APC

Sign In for Pricing
View Details
2-Hydroxyethylhydrazine
TRC-H942180-25G 25 g

2-Hydroxyethylhydrazine

Sign In for Pricing
View Details
SHIP (INPP5D) Rabbit Polyclonal Antibody
AP06313PU-N 100 µg

SHIP (INPP5D) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF647 conjugate, 0.1mg/mL
BNC471387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 Mouse Monoclonal Antibody [Clone ID: SPM547]
AM50191PU-S 100 µg

CD6 Mouse Monoclonal Antibody [Clone ID: SPM547]

Sign In for Pricing
View Details
Bufexamac
TRC-B689390-50MG 50 mg

Bufexamac

Sign In for Pricing
View Details