Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteocrin, Human (His)

Osteocrin protein regulates dendritic growth in the developing cerebral cortex by inhibiting branching. It is induced in the brain upon membrane depolarization and binds to the natriuretic peptide receptor NPR3/NPR-C, preventing the interaction with natriuretic peptides and increasing cproduction. Osteocrin also interacts with NPR3, further modulating dendritic growth regulation. Osteocrin Protein, Human (His) is the recombinant human-derived Osteocrin protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Osteocrin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/osteocrin-protein-human-his.html

Purity

98.0

Smiles

VDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG

Molecular Formula

344901 (Gene_ID) P61366 (V28-G133) (Accession)

Molecular Weight

Approximately 12.0-13.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS704104 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-52600-01 20 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-52600-02 60 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-52600-03 120 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
DIMT1 Polyclonal Antibody
E-AB-52600-04 200 µL

DIMT1 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638358 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details