Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A)

Product Specifications

Product Name Alternative

Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19

Abbreviation

Recombinant Guinea pig IL23A protein

Gene Name

IL23A

UniProt

Q6LA37

Expression Region

20-189aa

Organism

Cavia porcellus (Guinea pig)

Target Sequence

RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

References & Citations

"Molecular cloning and functional characterization of guinea pig interleukin-23." Shiratori I., Seya T. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal UbcH8/Ube2L6 Antibody
NBP3-38084-100ul 100 µL

Rabbit Polyclonal UbcH8/Ube2L6 Antibody

Ask
View Details
Human HORMA Domain Containing 2 (HORMAD2) ELISA Kit
abx385013 96 Tests

Human HORMA Domain Containing 2 (HORMAD2) ELISA Kit

Ask
View Details
Human DPH5 Pre-designed siRNA Set A
SI004518A 1 Each

Human DPH5 Pre-designed siRNA Set A

Ask
View Details
MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 405)
MBS6320006-01 0.1 mL

MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 405)

Ask
View Details
MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 405)
MBS6320006-02 5x 0.1 mL

MED25, NT (MED25, ACID1, ARC92, PTOV2, Mediator of RNA polymerase II transcription subunit 25, Activator interaction domain-containing protein 1, Activator-recruited cofactor 92kD component, Mediator complex subunit 25, p78) (MaxLight 405)

Ask
View Details
Mouse Monoclonal AlphaA Crystallin/CRYAA Antibody (c9F2) [Alexa Fluor 700]
NB120-14821AF700 0.1 mL

Mouse Monoclonal AlphaA Crystallin/CRYAA Antibody (c9F2) [Alexa Fluor 700]

Ask
View Details