Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human variant SIRP alpha (SIRPA)

Product Specifications

Product Name Alternative

Brain Ig-like molecule with tyrosine-based activation motifs ; BitCD172 antigen-like family member AInhibitory receptor SHPS-1Macrophage fusion receptorMyD-1 antigen; Signal-regulatory protein alpha-1 ; Sirp-alpha-1Signal-regulatory protein alpha-2 ; Sirp-alpha-2Signal-regulatory protein alpha-3 ; Sirp-alpha-3p84; CD172a

Abbreviation

Recombinant Human SIRPA protein

Gene Name

SIRPA

UniProt

P78324

Expression Region

1-131aa

Organism

Homo sapiens (Human)

Target Sequence

MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function . Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

References & Citations

"Mouse and human SHPS-1: molecular cloning of cDNAs and chromosomal localization of genes." Yamao T., Matozaki T., Amano K., Matsuda Y., Takahashi N., Ochi F., Fujioka Y., Kasuga M. Biochem. Biophys. Res. Commun. 231:61-67 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1B (NM_020441) Human Over-expression Lysate
LY402787 100 µg

CORO1B (NM_020441) Human Over-expression Lysate

Sign In for Pricing
View Details
Hydroxy Tyrosol-D4
TRC-H977002-25MG 25 mg

Hydroxy Tyrosol-D4

Sign In for Pricing
View Details
ING2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA800630BM 100 µL

ING2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
HSZFP36 (ZNF823) (NM_001080493) Human Over-expression Lysate
LC421048 20 µg

HSZFP36 (ZNF823) (NM_001080493) Human Over-expression Lysate

Sign In for Pricing
View Details
VCP Antibody
KC-1870-01 50 μL

VCP Antibody

Sign In for Pricing
View Details
VCP Antibody
KC-1870-02 100 µL

VCP Antibody

Sign In for Pricing
View Details