Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-31, Cynomolgus (HEK293, His)

IL-31 is a multifunctional cytokine that activates STAT3 through IL-31 heterodimeric receptors (IL31RA and OSMR) and may activate STAT1 and STAT5. IL-31 is known for its involvement in skin immunity, where it regulates immune responses. IL-31 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-31 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-31 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-31-protein-cynomolgus-hek293-his.html

Purity

96.00

Smiles

LPVHFLQPSDIQKIVEELQSLSKMLLKDVKEDKGVLVSQNYTLPCLTPDAQPPNIIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Molecular Formula

102135935 (Gene_ID) EHH66805 (L27-T163) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL
BNC681037-500 1x 500 µL

CD44 Standard (DF1485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details