Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-31, Cynomolgus (HEK293, His)

IL-31 is a multifunctional cytokine that activates STAT3 through IL-31 heterodimeric receptors (IL31RA and OSMR) and may activate STAT1 and STAT5. IL-31 is known for its involvement in skin immunity, where it regulates immune responses. IL-31 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-31 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-31 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-31-protein-cynomolgus-hek293-his.html

Purity

96.00

Smiles

LPVHFLQPSDIQKIVEELQSLSKMLLKDVKEDKGVLVSQNYTLPCLTPDAQPPNIIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT

Molecular Formula

102135935 (Gene_ID) EHH66805 (L27-T163) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKBKB Protein Lysate (Mouse) with C-HA Tag
24797035 100 µg

IKBKB Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral mouse Kif21a shRNA (UAS) - Lentiviral mouse Kif21a shRNA (UAS, iRFP) plasmid
GTR15193996 1 Vial

Lentiviral mouse Kif21a shRNA (UAS) - Lentiviral mouse Kif21a shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Porcine Tubulin specific chaperone D (TBCD) ELISA kit
GTR10453810 96 Well

Porcine Tubulin specific chaperone D (TBCD) ELISA kit

Sign In for Pricing
View Details
GNPAT Mouse Monoclonal Antibody [Clone ID: OTI2F8]
TA811143S 30 µL

GNPAT Mouse Monoclonal Antibody [Clone ID: OTI2F8]

Sign In for Pricing
View Details
3- (Trimethoxysilyl) propyl methacrylate
C03140-01 100 mg

3- (Trimethoxysilyl) propyl methacrylate

Sign In for Pricing
View Details
3- (Trimethoxysilyl) propyl methacrylate
C03140-02 1 g

3- (Trimethoxysilyl) propyl methacrylate

Sign In for Pricing
View Details