Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3 delta, Cynomolgus (HEK293, His)

CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD3 delta Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd3-delta-protein-cynomolgus-hek-293-his.html

Purity

95.0

Smiles

FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA

Molecular Formula

102133701 (Gene_ID) Q95LI8 (F22-A105) (Accession)

Molecular Weight

20-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isopentyl Pentyl Phthalate
280528-01 25 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
280528-02 50 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
280528-03 100 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
280528-04 250 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Isopentyl Pentyl Phthalate
280528-05 500 mg

Isopentyl Pentyl Phthalate

Sign In for Pricing
View Details
Recombinant Human EIF3F Protein, N-His
MBS1587100-01 0.1 mg

Recombinant Human EIF3F Protein, N-His

Sign In for Pricing
View Details