Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Growth Hormone R/GHR, Rat (HEK293, His)

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, His) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Growth Hormone R/GHR Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/growth-hormone-r-ghr-protein-rat-hek293-his.html

Purity

95.00

Smiles

FPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFR

Molecular Formula

25235 (Gene_ID) P16310-1 (F19-R265) (Accession)

Molecular Weight

35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome 20S alpha 2 Recombinant Rabbit mAb
BS47013-01 50 µL

Proteasome 20S alpha 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Proteasome 20S alpha 2 Recombinant Rabbit mAb
BS47013-02 100 µL

Proteasome 20S alpha 2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Fmoc-Glu (OtBu) -OH · H₂O
4003082.0100 100 g

Fmoc-Glu (OtBu) -OH · H₂O

Sign In for Pricing
View Details
Ctdsp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4597106 1.0 µg DNA

Ctdsp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
AXL (Phospho-Tyr702) Antibody
orb2657020 100 µL

AXL (Phospho-Tyr702) Antibody

Sign In for Pricing
View Details
Roto-Mini Rotator with tube holders 230V
MIX7050 1 Each

Roto-Mini Rotator with tube holders 230V

Sign In for Pricing
View Details