Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QPCT, Mouse (HEK293, His-Myc)

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag.

Product Specifications

Product Name Alternative

QPCT Protein, Mouse (HEK293, His-Myc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/qpct-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Molecular Formula

70536 (Gene_ID) Q9CYK2-1 (A36-L362) (Accession)

Molecular Weight

Approximately 41.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RSF1 Pre-designed siRNA Set B
SI014118B 1 Each

Human RSF1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cdca8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6564305 3x 1.0 µg

Cdca8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
mmu-miR-653-3p miRNA Agomir
MBS8314279-01 5 nmol

mmu-miR-653-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-653-3p miRNA Agomir
MBS8314279-02 10 nmol

mmu-miR-653-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-653-3p miRNA Agomir
MBS8314279-03 20 nmol

mmu-miR-653-3p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-653-3p miRNA Agomir
MBS8314279-04 5x 20 nmol

mmu-miR-653-3p miRNA Agomir

Sign In for Pricing
View Details