Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QPCT, Mouse (HEK293, His-Myc)

The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag.

Product Specifications

Product Name Alternative

QPCT Protein, Mouse (HEK293, His-Myc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/qpct-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Molecular Formula

70536 (Gene_ID) Q9CYK2-1 (A36-L362) (Accession)

Molecular Weight

Approximately 41.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCLRE1B Antibody
ABD9444 100 µg

DCLRE1B Antibody

Sign In for Pricing
View Details
NUP62 (Nuclear Pore Glycoprotein p62, 62kD Nucleoporin, Nucleoporin Nup62) (AP) discontinued
130654-AP 100 µL

NUP62 (Nuclear Pore Glycoprotein p62, 62kD Nucleoporin, Nucleoporin Nup62) (AP) discontinued

Sign In for Pricing
View Details
HLA-DQA1 Blocking Peptide (N-term)
MBS9229956-01 0.5 mg

HLA-DQA1 Blocking Peptide (N-term)

Sign In for Pricing
View Details
HLA-DQA1 Blocking Peptide (N-term)
MBS9229956-02 5x 0.5 mg

HLA-DQA1 Blocking Peptide (N-term)

Sign In for Pricing
View Details
Mouse Fetuin A, FETU-A ELISA Kit
MBS162906-01 48 Well

Mouse Fetuin A, FETU-A ELISA Kit

Sign In for Pricing
View Details
Mouse Fetuin A, FETU-A ELISA Kit
MBS162906-02 96 Well

Mouse Fetuin A, FETU-A ELISA Kit

Sign In for Pricing
View Details