Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 (CD147 Antigen, 5A11 Antigen, 5F7, Basigin, BSG, Blood Brain Barrier HT7 Antigen, Collagenase Stimulatory Factor, Emmprin, Extracellular Matrix Metalloproteinase Inducer, Leukocyte Activation Antigen M6, M6, M6 Antigen, Neurothelin, OK, OK Blood Group Antigen, Tumor Cell-derived Collagenase Stimulatory Factor, TCSF) (AP) discontinued
C2548-80C-AP 100 µL

CD147 (CD147 Antigen, 5A11 Antigen, 5F7, Basigin, BSG, Blood Brain Barrier HT7 Antigen, Collagenase Stimulatory Factor, Emmprin, Extracellular Matrix Metalloproteinase Inducer, Leukocyte Activation Antigen M6, M6, M6 Antigen, Neurothelin, OK, OK Blood Group Antigen, Tumor Cell-derived Collagenase Stimulatory Factor, TCSF) (AP) discontinued

Sign In for Pricing
View Details
Caspase 8 (CASP8) (NM_001080125) Human Tagged ORF Clone
RG216300 10 µg

Caspase 8 (CASP8) (NM_001080125) Human Tagged ORF Clone

Sign In for Pricing
View Details
GJB1 Protein Vector (Mouse) (pPB-C-His)
PV182086 500 ng

GJB1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
RNF22 (TRIM3) (NM_033278) Human Over-expression Lysate
LH13154V 100 µg

RNF22 (TRIM3) (NM_033278) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2H (NM_003344) Human Recombinant Protein
TP302516L 1 mg

UBE2H (NM_003344) Human Recombinant Protein

Sign In for Pricing
View Details
Itgal sgRNA CRISPR Lentivector (Rat) (Target 3)
K7290004 1.0 µg DNA

Itgal sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details