Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Phosphatase 2A, alpha (PP2Aa) (MaxLight 490) discontinued
P9107-33E-ML490 100 µL

Protein Phosphatase 2A, alpha (PP2Aa) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Slc26a4 3'UTR GFP Stable Cell Line
TU270560 1.0 mL

Slc26a4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Spata3 (NM_028647) Mouse Tagged Lenti ORF Clone
MR219003L4 10 µg

Spata3 (NM_028647) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RASL10B Antibody
C18206-01 50 μL

RASL10B Antibody

Sign In for Pricing
View Details
RASL10B Antibody
C18206-02 100 µL

RASL10B Antibody

Sign In for Pricing
View Details
Apolipoprotein AII (Apo AII) (APC)
MBS6463624-01 0.1 mL

Apolipoprotein AII (Apo AII) (APC)

Sign In for Pricing
View Details