Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elof1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3525908 1.0 µg DNA

Elof1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor (erbB, EGFR), Neutralizing (MaxLight 650)
E3375-14-ML650 100 µL

Epidermal Growth Factor Receptor (erbB, EGFR), Neutralizing (MaxLight 650)

Sign In for Pricing
View Details
OR1J4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1487906 1.0 µg DNA

OR1J4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RBAK Adenovirus (Human)
38569051 1.0 mL

RBAK Adenovirus (Human)

Sign In for Pricing
View Details
Lentiviral human AK3 sgRNA gene knockout kit - Lentiviral human AK3 sgRNA gene knockout kit (25)
GTR15377271 1 Vial

Lentiviral human AK3 sgRNA gene knockout kit - Lentiviral human AK3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Bovine Myosin VB (MYO5B) ELISA Kit
MBS9913173-01 48 Well

Bovine Myosin VB (MYO5B) ELISA Kit

Sign In for Pricing
View Details