MIP-3 alpha/CCL20, Bovine (His-SUMO)
The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Product Specifications
Product Name Alternative
MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html
Smiles
ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM
Molecular Formula
281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)
Molecular Weight
24.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
