Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AKR1E2 sgRNA gene knockout kit - Lentiviral human AKR1E2 sgRNA gene knockout kit (100)
GTR15400150 1 Vial

Lentiviral human AKR1E2 sgRNA gene knockout kit - Lentiviral human AKR1E2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TRIM11 discontinued
515299 100 µg

TRIM11 discontinued

Sign In for Pricing
View Details
USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (MaxLight 490)
MBS6398189-01 0.1 mL

USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (MaxLight 490)

Sign In for Pricing
View Details
USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (MaxLight 490)
MBS6398189-02 5x 0.1 mL

USP18 (Ubiquitin Specific Peptidase 18, Ubl Carboxyl-terminal Hydrolase 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Thioesterase 18, UBP43) (MaxLight 490)

Sign In for Pricing
View Details
NIT1
570185-01 50 µg

NIT1

Sign In for Pricing
View Details
NIT1
570185-02 100 µg

NIT1

Sign In for Pricing
View Details