Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2L1 (NM_016112) Human Tagged Lenti ORF Clone
RC206480L3 10 µg

PKD2L1 (NM_016112) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Acetovanillone (Apocynin)
299875 20 mg

Acetovanillone (Apocynin)

Sign In for Pricing
View Details
Human Rho GTPase-activating protein 11A (ARHGAP11A) ELISA Kit
RK12238 96 Tests

Human Rho GTPase-activating protein 11A (ARHGAP11A) ELISA Kit

Sign In for Pricing
View Details
Keratin 18 (Cytokeratin 18, Keratin, Type I Cytoskeletal 18) (AP)
MBS6122285-01 0.1 mL

Keratin 18 (Cytokeratin 18, Keratin, Type I Cytoskeletal 18) (AP)

Sign In for Pricing
View Details
Keratin 18 (Cytokeratin 18, Keratin, Type I Cytoskeletal 18) (AP)
MBS6122285-02 5x 0.1 mL

Keratin 18 (Cytokeratin 18, Keratin, Type I Cytoskeletal 18) (AP)

Sign In for Pricing
View Details
SCZD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2106205 3x 1.0 µg

SCZD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details