Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-60572R-PE-Cy7 100 µL

PSMA1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Carbohydrate sulfotransferase 4, Chst4 ELISA KIT
ELI-25285m 96 Tests

Mouse Carbohydrate sulfotransferase 4, Chst4 ELISA KIT

Sign In for Pricing
View Details
GDF5 ORF Vector (Human) (pORF)
ORF004356 1.0 µg DNA

GDF5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial
MBS1432478-01 0.02 mg (E-Coli)

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial

Sign In for Pricing
View Details
Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial
MBS1432478-02 0.1 mg (E-Coli)

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial

Sign In for Pricing
View Details
Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial
MBS1432478-03 1 mg (E-Coli)

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial

Sign In for Pricing
View Details