Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Bovine (His-SUMO)

The MIP-3 α/CCL20 protein acts as a ligand for CCR6, inducing an efficient chemotactic response and intracellular calcium mobilization upon CCR6 binding. The CCL20-CCR6 pair is critical in chemotaxis, attracting dendritic cells, effector/memory T cells, and B cells, especially to skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO), Bovine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-bovine-his-sumo.html

Smiles

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Molecular Formula

281666 (Gene_ID) Q8SQB1 (A27-M96) (Accession)

Molecular Weight

24.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Discovery Luminex Assay
LXSAPM-14 1 Kit

Porcine Discovery Luminex Assay

Sign In for Pricing
View Details
Human WASP MAb (Clone 336925)
MAB3070-SP 25 µg

Human WASP MAb (Clone 336925)

Sign In for Pricing
View Details
ZNF513 siRNA (Mouse)
MBS8215795-01 15 nmol

ZNF513 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF513 siRNA (Mouse)
MBS8215795-02 30 nmol

ZNF513 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF513 siRNA (Mouse)
MBS8215795-03 5x 30 nmol

ZNF513 siRNA (Mouse)

Sign In for Pricing
View Details
YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)
MBS6506360-01 0.2 mL

YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)

Sign In for Pricing
View Details