Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Canine (HEK293, Fc)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Canine (HEK293, Fc) is produced in HEK293 cells with a N-Terminal Fc-tag. It consists of 103 amino acids (R109-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Canine (HEK293, Fc), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-canine-hek293-fc.html

Purity

98.00

Smiles

RGPRGRNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETMYDKILKNLSKSRRLASDKAGQACCRPIAYDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

489224 (Gene_ID) XP_005619436.1 (R83-I185) (Accession)

Molecular Weight

Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy5 Goat Anti-Human IgG (H+L) Antibody
K1211-1 1 mL

Cy5 Goat Anti-Human IgG (H+L) Antibody

Sign In for Pricing
View Details
CREL1 Polyclonal Antibody
ABP58266-01 30 µL

CREL1 Polyclonal Antibody

Sign In for Pricing
View Details
CREL1 Polyclonal Antibody
ABP58266-02 100 µL

CREL1 Polyclonal Antibody

Sign In for Pricing
View Details
CREL1 Polyclonal Antibody
ABP58266-03 200 µL

CREL1 Polyclonal Antibody

Sign In for Pricing
View Details
Thymidine Kinase discontinued
346248-01 100 µL

Thymidine Kinase discontinued

Sign In for Pricing
View Details
Thymidine Kinase discontinued
346248-02 200 µL

Thymidine Kinase discontinued

Sign In for Pricing
View Details