Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)

Product Specifications

Product Name Alternative

Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL

Abbreviation

Recombinant Human CLEC4C protein, partial (Active)

Gene Name

CLEC4C

UniProt

Q8WTT0

Expression Region

45-213aa

Organism

Homo sapiens (Human)

Target Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Tag

N-terminal 6xHis-Myc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

May play a role in antigen capturing by dendritic cells.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody (CSB-RA855470MA1HU), the EC50 is 7.658-12.99 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.1 kDa

References & Citations

"Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31:2733-2740 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GABPA shRNA Plasmid
abx970434-01 150 µg

Mouse GABPA shRNA Plasmid

Sign In for Pricing
View Details
Mouse GABPA shRNA Plasmid
abx970434-02 300 µg

Mouse GABPA shRNA Plasmid

Sign In for Pricing
View Details
Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit
MBS7234890-01 48 Well

Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit
MBS7234890-02 96 Well

Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit
MBS7234890-03 5x 96 Well

Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit
MBS7234890-04 10x 96 Well

Porcine Olfactory receptor 3A2 (OR3A2) ELISA Kit

Sign In for Pricing
View Details