Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SVMP, Crotalus adamanteus (His)

SVMP protein, while lacking significant hemorrhagic activity, functions by inactivating serpins through limited proteolysis of their reactive-site loops. SVMP Protein, Crotalus adamanteus (His) is the recombinant SVMP protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

SVMP Protein, Crotalus adamanteus (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/svmp-protein-crotalus-adamanteus-his.html

Purity

90.00

Smiles

QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP

Molecular Formula

/ (Gene_ID) P34179 (Q1-P203) (Accession)

Molecular Weight

Approximately 27.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filamin A (PT0388R) PT® Rabbit mAb
YM8238-01 40 µL

Filamin A (PT0388R) PT® Rabbit mAb

Sign In for Pricing
View Details
Filamin A (PT0388R) PT® Rabbit mAb
YM8238-02 100 μL

Filamin A (PT0388R) PT® Rabbit mAb

Sign In for Pricing
View Details
Filamin A (PT0388R) PT® Rabbit mAb
YM8238-03 200 μL

Filamin A (PT0388R) PT® Rabbit mAb

Sign In for Pricing
View Details
RGD1562665 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6497408 1.0 µg DNA

RGD1562665 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CDKN2A Polyclonal Antibody
E55A01870 100 µg

CDKN2A Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SFTS Virus HB29 Antibody [DyLight 405]
NBP2-41156V 0.1 mL

Rabbit Polyclonal SFTS Virus HB29 Antibody [DyLight 405]

Sign In for Pricing
View Details