Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HE4/WFDC2, Canine (HEK293, Fc)

HE4/WFDC2 protein acts as a broad-spectrum protease inhibitor and may affect a variety of cellular processes. Its effect on sperm maturation suggests its role in reproductive mechanisms. HE4/WFDC2 Protein, Canine (HEK293, Fc) is the recombinant canine-derived HE4/WFDC2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

HE4/WFDC2 Protein, Canine (HEK293, Fc), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/he4-wfdc2-protein-canine-hek293-fc.html

Purity

98.0

Smiles

GEVEKTGVCPQLQADLNCTQECVSDAQCADNLKCCQAGCATICHLPNEKEGSCPQVNTDFPQLGLCQDQCQVDSHCPGLLKCCYNGCGKVSCVTPIF

Molecular Formula

403919 (Gene_ID) Q28894/NP_001003241.1 (G28-F124) (Accession)

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM64A Recombinant Protein (Rat)
RP200717 100 µg

FAM64A Recombinant Protein (Rat)

Sign In for Pricing
View Details
TM4SF18 Human Over-expression Lysate
orb1339426 100 µg

TM4SF18 Human Over-expression Lysate

Sign In for Pricing
View Details
TAS2R103 siRNA (Rat)
orb1827005-01 15 nmol

TAS2R103 siRNA (Rat)

Sign In for Pricing
View Details
TAS2R103 siRNA (Rat)
orb1827005-02 30 nmol

TAS2R103 siRNA (Rat)

Sign In for Pricing
View Details
VPS53 Human Pre-designed siRNA Set A
HY-RS15698 1 Set

VPS53 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
APOBEC3C Knockout CAL27 Polyclonal Cells
ARG35840 1 Million

APOBEC3C Knockout CAL27 Polyclonal Cells

Sign In for Pricing
View Details