KGF/FGF-7, Mouse
FGF-7 Protein, Mouse is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.
Product Specifications
Product Name Alternative
KGF/FGF-7 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-7-protein-mouse.html
Purity
98.0
Smiles
CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
Molecular Formula
14178 (Gene_ID) P36363 (C32-T194) (Accession)
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Tichelaar JW, et al. Conditional expression of fibroblast growth factor-7 in the developing and mature lung. J Biol Chem. 2000 Apr 21;275 (16) :11858-64.|[2]Mongiat M, et al. The protein core of the proteoglycan perlecan binds specifically to fibroblast growth factor-7. J Biol Chem. 2000 Mar 10;275 (10) :7095-100.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP208244 200 Reactions
PIP5K2 alpha (PIP4K2A) Human qPCR Primer Pair (NM_005028)
Sign In for Pricing
View Details 
QL03F0823Z Pack of 250
Pack of 250 Sheets of Medium Qualitative Filter, 77X228 Mm
Sign In for Pricing
View Details