What is the catalog number for KGF/FGF-7, Mouse?

The catalog number for KGF/FGF-7, Mouse is HY-P7176.

What sizes are available for KGF/FGF-7, Mouse?

KGF/FGF-7, Mouse is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does KGF/FGF-7, Mouse come in?

KGF/FGF-7, Mouse is available in 4 different pack sizes.

Is KGF/FGF-7, Mouse in stock?

KGF/FGF-7, Mouse is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures KGF/FGF-7, Mouse?

KGF/FGF-7, Mouse is manufactured by QuantiMol.

What is the estimated delivery time for KGF/FGF-7, Mouse?

Estimated delivery time for KGF/FGF-7, Mouse is approximately 15 business day(s), depending on your location.

KGF/FGF-7, Mouse

FGF-7 Protein, Mouse is a potent mitogen that enhances cell proliferation in various organs, including the skin, intestine, breast, liver, and lung.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-7-protein-mouse.html

Purity

98.0

Smiles

CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Molecular Formula

14178 (Gene_ID) P36363 (C32-T194) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Tichelaar JW, et al. Conditional expression of fibroblast growth factor-7 in the developing and mature lung. J Biol Chem. 2000 Apr 21;275 (16) :11858-64.|[2]Mongiat M, et al. The protein core of the proteoglycan perlecan binds specifically to fibroblast growth factor-7. J Biol Chem. 2000 Mar 10;275 (10) :7095-100.