Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIN1 (MAPKAP1) (NM_024117) Human 3' UTR Clone
SC214895 10 µg

SIN1 (MAPKAP1) (NM_024117) Human 3' UTR Clone

Sign In for Pricing
View Details
Human Vascuoar endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA Kit
GA-E0265HM-01 48 Tests

Human Vascuoar endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA Kit

Sign In for Pricing
View Details
Human Vascuoar endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA Kit
GA-E0265HM-02 96 Tests

Human Vascuoar endothelial cell growth factor receptor 1 (VEGFR-1/Flt1) ELISA Kit

Sign In for Pricing
View Details
POU2F1 siRNA (Human)
CRH3653-01 15 nmol

POU2F1 siRNA (Human)

Sign In for Pricing
View Details
POU2F1 siRNA (Human)
CRH3653-02 30 nmol

POU2F1 siRNA (Human)

Sign In for Pricing
View Details
GPR75 3'UTR Luciferase Stable Cell Line
TU009179 1.0 mL

GPR75 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details