Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHLPP2 Recombinant Protein Antigen
NBP3-17909PEP 0.1 mL

PHLPP2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit Monoclonal CD59 Antibody (029) [PerCP]
NBP2-90112PCP 0.1 mL

Rabbit Monoclonal CD59 Antibody (029) [PerCP]

Sign In for Pricing
View Details
Human OSBPL6 activation kit by CRISPRa
GA114480 1 Kit

Human OSBPL6 activation kit by CRISPRa

Sign In for Pricing
View Details
WFDC5 (WAP Four Disulfide Core Domain Protein 5, WAP1, Putative protease inhibitor WAP1, p53-responsive gene 5 protein)
365594 200 µL

WFDC5 (WAP Four Disulfide Core Domain Protein 5, WAP1, Putative protease inhibitor WAP1, p53-responsive gene 5 protein)

Sign In for Pricing
View Details
EIF4B (phospho Ser422) Rabbit Polyclonal Antibody
E28PP0280 100 µL

EIF4B (phospho Ser422) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myt1, phosphorylated (Ser83) (PKMYT1, MYT 1, Membrane-associated tyrosine- and threonine-specific cdc2-Inhibitory kinase, Myt1 kinase)
325060 100 µL

Myt1, phosphorylated (Ser83) (PKMYT1, MYT 1, Membrane-associated tyrosine- and threonine-specific cdc2-Inhibitory kinase, Myt1 kinase)

Sign In for Pricing
View Details