Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1 polyclonal antibody
BS7227-01 50 µL

UHRF1 polyclonal antibody

Sign In for Pricing
View Details
UHRF1 polyclonal antibody
BS7227-02 100 µL

UHRF1 polyclonal antibody

Sign In for Pricing
View Details
Thymic Stromal Lymphopoietin Protein Receptor (Cytokine Receptor-Like 2, TSLP-R, TSLP Receptor, IL-XR, CRLF2, CRL2, ILXR, TSLPR) (MaxLight 490)
MBS6502553-01 0.1 mL

Thymic Stromal Lymphopoietin Protein Receptor (Cytokine Receptor-Like 2, TSLP-R, TSLP Receptor, IL-XR, CRLF2, CRL2, ILXR, TSLPR) (MaxLight 490)

Sign In for Pricing
View Details
Thymic Stromal Lymphopoietin Protein Receptor (Cytokine Receptor-Like 2, TSLP-R, TSLP Receptor, IL-XR, CRLF2, CRL2, ILXR, TSLPR) (MaxLight 490)
MBS6502553-02 5x 0.1 mL

Thymic Stromal Lymphopoietin Protein Receptor (Cytokine Receptor-Like 2, TSLP-R, TSLP Receptor, IL-XR, CRLF2, CRL2, ILXR, TSLPR) (MaxLight 490)

Sign In for Pricing
View Details
OST-PTP siRNA (m)
sc-151334 10 µM

OST-PTP siRNA (m)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Ribose-5-phosphate isomerase A (rpiA)
MBS1423332-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri Ribose-5-phosphate isomerase A (rpiA)

Sign In for Pricing
View Details