Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OTUD4 Antibody [DyLight 650]
NBP2-37690C 0.1 mL

Rabbit Polyclonal OTUD4 Antibody [DyLight 650]

Sign In for Pricing
View Details
Mouse APOA4 Matched Antibody Pair Set [ABP-S-04239]
ABP-S-04239 5 Plates

Mouse APOA4 Matched Antibody Pair Set [ABP-S-04239]

Sign In for Pricing
View Details
INTU Protein Vector (Human) (pPM-C-HA)
PV053499 500 ng

INTU Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Fam155a Mouse shRNA Plasmid (Locus ID 270028)
TL508112 1 Kit

Fam155a Mouse shRNA Plasmid (Locus ID 270028)

Sign In for Pricing
View Details
Human Cold inducible RNA binding protein, CIRBP ELISA Kit
MBS1608134-01 48 Well

Human Cold inducible RNA binding protein, CIRBP ELISA Kit

Sign In for Pricing
View Details
Human Cold inducible RNA binding protein, CIRBP ELISA Kit
MBS1608134-02 96 Well

Human Cold inducible RNA binding protein, CIRBP ELISA Kit

Sign In for Pricing
View Details