Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF10 sgRNA CRISPR Lentivector (Human) (Target 3)
K0118204 1.0 µg DNA

ARHGEF10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Slc25a3 (NM_133668) Mouse Tagged ORF Clone Lentiviral Particle
MR205459L4V 200 µL

Slc25a3 (NM_133668) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD59 (MACIF, MIRL, Protectin) (Biotin)
C2413-21C-Biotin 100 µL

CD59 (MACIF, MIRL, Protectin) (Biotin)

Sign In for Pricing
View Details
TMEM37 (NM_183240) Human 3' UTR Clone
SC212290 10 µg

TMEM37 (NM_183240) Human 3' UTR Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Mouse IgG3 Secondary Antibody [Biotin]
NBP1-72796B-0.5mL 0.5 mL

Rabbit Polyclonal Rabbit anti-Mouse IgG3 Secondary Antibody [Biotin]

Sign In for Pricing
View Details
EPAS1/HIF2α Rabbit pAb
E45R27494N-100 100 µL

EPAS1/HIF2α Rabbit pAb

Sign In for Pricing
View Details