Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O157:H7 CAIE Polyclonal Antibody
MBS9004112 Inquire

Rabbit anti-Escherichia coli O157:H7 CAIE Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human FABP2 shRNA (UAS) - Lentiviral human FABP2 shRNA (UAS, GFP) (25)
GTR15160256 1 Vial

Lentiviral human FABP2 shRNA (UAS) - Lentiviral human FABP2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Dapk3 shRNA (UAS) - Lentiviral mouse Dapk3 shRNA (UAS, GFP) (100)
GTR15227553 1 Vial

Lentiviral mouse Dapk3 shRNA (UAS) - Lentiviral mouse Dapk3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
BC051070 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4176305 3x 1.0 µg

BC051070 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Hmgcs1 ELISA KIT
ELI-05710m 96 Tests

Mouse Hmgcs1 ELISA KIT

Sign In for Pricing
View Details
General Receptor for phosphoinositides 1 (GRASP) (NM_181711) Human Tagged ORF Clone
RC208808 10 µg

General Receptor for phosphoinositides 1 (GRASP) (NM_181711) Human Tagged ORF Clone

Sign In for Pricing
View Details