Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1AL10 sgRNA CRISPR Lentivector set (Human)
K0656201 3x 1.0 µg

EEF1AL10 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CHMP5, CT (CHMP5, C9orf83, SNF7DC2, Charged multivesicular body protein 5, Chromatin-modifying protein 5, SNF7 domain-containing protein 2, Vacuolar protein sorting-associated protein 60) (MaxLight 750) discontinued
033854-ML750 100 µL

CHMP5, CT (CHMP5, C9orf83, SNF7DC2, Charged multivesicular body protein 5, Chromatin-modifying protein 5, SNF7 domain-containing protein 2, Vacuolar protein sorting-associated protein 60) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal SNF1LK2/SIK2 Antibody (S15G10)
NBP3-27941 0.05 mg

Mouse Monoclonal SNF1LK2/SIK2 Antibody (S15G10)

Sign In for Pricing
View Details
Human Plakophilin 1 (PKP1) ELISA Kit
RDR-PKP1-Hu-01 96 Tests

Human Plakophilin 1 (PKP1) ELISA Kit

Sign In for Pricing
View Details
Human Plakophilin 1 (PKP1) ELISA Kit
RDR-PKP1-Hu-02 48 Tests

Human Plakophilin 1 (PKP1) ELISA Kit

Sign In for Pricing
View Details
Arid3a Mouse qPCR Primer Pair (NM_007880)
MP200990 200 Reactions

Arid3a Mouse qPCR Primer Pair (NM_007880)

Sign In for Pricing
View Details