Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF16B (NM_024704) Human Tagged ORF Clone
RC218038 10 µg

KIF16B (NM_024704) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal ORC6L Antibody [Alexa Fluor 350]
NB100-74620AF350 0.1 mL

Rabbit Polyclonal ORC6L Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
SLC27A5-set siRNA/shRNA/RNAi Lentivector (Human)
44079091 4x 500 ng

SLC27A5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
RN5S460 Protein Lysate (Human) with C-Ha Tag
40052031 100 µg

RN5S460 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) Porcine ELISA Kit
H0835 96 Tests

SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) Porcine ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal HIP-55 Antibody (OTI6C9) [HRP]
NBP2-71841H 0.1 mL

Mouse Monoclonal HIP-55 Antibody (OTI6C9) [HRP]

Sign In for Pricing
View Details