Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6926 Mouse qPCR Primer Pair (MI0022773)
MP300910 200 Reactions

MIR6926 Mouse qPCR Primer Pair (MI0022773)

Sign In for Pricing
View Details
GJA3 (NM_021954) Human Tagged ORF Clone Lentiviral Particle
RC216756L3V 200 µL

GJA3 (NM_021954) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SCYL1BP1 (GORAB) (NM_152281) Human 3' UTR Clone
SC214192 10 µg

SCYL1BP1 (GORAB) (NM_152281) Human 3' UTR Clone

Sign In for Pricing
View Details
ZNRF4 Human Gene Knockout Kit (CRISPR)
KN405571 1 Kit

ZNRF4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATL1 Conjugated Antibody
MBS9443850-01 0.1 mL (Biotin)

ATL1 Conjugated Antibody

Sign In for Pricing
View Details
ATL1 Conjugated Antibody
MBS9443850-02 0.1 mL (AF350)

ATL1 Conjugated Antibody

Sign In for Pricing
View Details