Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXA1 Antibody
A22198-50UG 50 µg

FOXA1 Antibody

Sign In for Pricing
View Details
Phospho-SYN1 (S9) Antibody
A11086-100UG 100 µg

Phospho-SYN1 (S9) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Slc25a33 shRNA (UAS) - Lentiviral mouse Slc25a33 shRNA (UAS, RFP) (100)
GTR15243456 1 Vial

Lentiviral mouse Slc25a33 shRNA (UAS) - Lentiviral mouse Slc25a33 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral mouse Pou3f1 shRNA (UAS) - Lentiviral mouse Pou3f1 shRNA (UAS) plasmid
GTR15183907 1 Vial

Lentiviral mouse Pou3f1 shRNA (UAS) - Lentiviral mouse Pou3f1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Thioredoxin-like Protein 1, Recombinant, Human, aa2-289, His-SUMO-Tag
586490-01 20 µg

Thioredoxin-like Protein 1, Recombinant, Human, aa2-289, His-SUMO-Tag

Sign In for Pricing
View Details
Thioredoxin-like Protein 1, Recombinant, Human, aa2-289, His-SUMO-Tag
586490-02 100 µg

Thioredoxin-like Protein 1, Recombinant, Human, aa2-289, His-SUMO-Tag

Sign In for Pricing
View Details