Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 22 Receptor Alpha 2 ELISA Kit (IL22Ra2)
RK01669 96 Tests

Human Interleukin 22 Receptor Alpha 2 ELISA Kit (IL22Ra2)

Sign In for Pricing
View Details
(Z) -1,1,1,3-Tetrafluorobut-2-ene
sc-264504 5 g

(Z) -1,1,1,3-Tetrafluorobut-2-ene

Sign In for Pricing
View Details
Recombinant Influenza H5N1 Indonesia Protein, Untagged, Insect-2ug
QP12093-2ug 2ug

Recombinant Influenza H5N1 Indonesia Protein, Untagged, Insect-2ug

Sign In for Pricing
View Details
Rabbit Polyclonal ABCB5 Antibody [DyLight 680]
NBP2-98737FR 0.1 mL

Rabbit Polyclonal ABCB5 Antibody [DyLight 680]

Sign In for Pricing
View Details
Lentiviral human TFAM sgRNA gene knockout kit - Lentiviral human TFAM sgRNA gene knockout kit (plasmid)
GTR15396674 1 Vial

Lentiviral human TFAM sgRNA gene knockout kit - Lentiviral human TFAM sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SPINK7 (NM_032566) Human Untagged Clone
SC305476 10 µg

SPINK7 (NM_032566) Human Untagged Clone

Sign In for Pricing
View Details