Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Synaptophysin Protein, SYP ELISA KIT
E6462Hu-01 48 Well

Human Synaptophysin Protein, SYP ELISA KIT

Sign In for Pricing
View Details
Human Synaptophysin Protein, SYP ELISA KIT
E6462Hu-02 96 Well

Human Synaptophysin Protein, SYP ELISA KIT

Sign In for Pricing
View Details
Human Synaptophysin Protein, SYP ELISA KIT
E6462Hu-03 5x 96 Tests

Human Synaptophysin Protein, SYP ELISA KIT

Sign In for Pricing
View Details
Human Synaptophysin Protein, SYP ELISA KIT
E6462Hu-04 10x 96 Tests

Human Synaptophysin Protein, SYP ELISA KIT

Sign In for Pricing
View Details
Magnetic Microbial DNA extraction kit
M004064 100 Tests

Magnetic Microbial DNA extraction kit

Sign In for Pricing
View Details
HSPC142 Antibody (Center) Blocking Peptide
MBS9227711-01 0.5 mg

HSPC142 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details