Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-NR1H3-sgRNA2-CAS9-EGFP-Puro Plasmid
PVT61219 2 µg

pLV3-U6-NR1H3-sgRNA2-CAS9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
TMED11P AAV Vector (Human) (CMV)
46841101 1 µg

TMED11P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mycoplasma pneumoniae
M9750-15K 1 mg

Mycoplasma pneumoniae

Sign In for Pricing
View Details
Me3 Mouse siRNA Oligo Duplex (Locus ID 109264)
SR418072 1 Kit

Me3 Mouse siRNA Oligo Duplex (Locus ID 109264)

Sign In for Pricing
View Details
ST3GAL5 Recombinant Protein (Human)
RP030229 100 µg

ST3GAL5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Sheep Anti-cyclic cirtullinated peptide ELISA Kit
MBS748595-01 48 Well

Sheep Anti-cyclic cirtullinated peptide ELISA Kit

Sign In for Pricing
View Details