Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) (HRP)
MBS6151303-01 0.1 mL

ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) (HRP)

Sign In for Pricing
View Details
ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) (HRP)
MBS6151303-02 5x 0.1 mL

ASB8 (Ankyrin Repeat and SOCS Box Protein 8, ASB-8, PP14212, FLJ21255, MGC5540) (HRP)

Sign In for Pricing
View Details
ZNF238 (ZBTB18) Human shRNA Lentiviral Particle (Locus ID 10472)
TL300278V 500 µL Each

ZNF238 (ZBTB18) Human shRNA Lentiviral Particle (Locus ID 10472)

Sign In for Pricing
View Details
ADAM12 Protein Vector (Human) (pPB-His-GST)
PV319723 500 ng

ADAM12 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Mir320 Mouse qPCR Template Standard (MI0000704)
MK300253 200 Reactions

Mir320 Mouse qPCR Template Standard (MI0000704)

Sign In for Pricing
View Details
STIP1 Protein Vector (Human) (pPM-C-HA)
PV040519 500 ng

STIP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details