Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fars2 ORF Vector (Rat) (pORF)
ORF066953 1.0 µg DNA

Fars2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DCUN1D4 Polyclonal Antibody
bs-8251R 100 µL

DCUN1D4 Polyclonal Antibody

Sign In for Pricing
View Details
Asb9 (NM_027027) Mouse Recombinant Protein
PM43623M5 20 µg

Asb9 (NM_027027) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Integrin alpha-2 Protein, His-SUMO, E.coli-1mg
QP6238-ec-1mg 1mg

Recombinant Human Integrin alpha-2 Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
c-Myc Peptide
AF7674-BP 1 mg

c-Myc Peptide

Sign In for Pricing
View Details
CYP20A1 3'UTR GFP Stable Cell Line
TU055503 1.0 mL

CYP20A1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details