Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM3 Protein Vector (Rat) (pPM-C-His)
PV271813 500 ng

GSTM3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Streptococcus suis ApuA Polyclonal Antibody
E55A05288 100 µg

Streptococcus suis ApuA Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rnhA Protein (aa 1-156) (strain ATCC 39315 / El Tor Inaba N16961)
VAng-Cr3470-50gEcoli 50 µg (E. coli)

Recombinant Vibrio Cholerae rnhA Protein (aa 1-156) (strain ATCC 39315 / El Tor Inaba N16961)

Sign In for Pricing
View Details
RNA Sample Loading Buffer With Ethidium Bromide 50g/mL
10450018-1 25 mL

RNA Sample Loading Buffer With Ethidium Bromide 50g/mL

Sign In for Pricing
View Details
RNU5E-3P AAV Vector (Human) (CMV)
40414101 1 µg

RNU5E-3P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
NOC2L Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-7618R-PerCP-Cy5.5 100 µL

NOC2L Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details