Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT3 (NM_004083) Human Untagged Clone
SC324377 10 µg

DDIT3 (NM_004083) Human Untagged Clone

Sign In for Pricing
View Details
UBE2D2 Polyclonal Antibody, APC Conjugated
bs-8348R-APC 100 µL

UBE2D2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Human Syndecan-3 MAb (Clone 374420)
MAB3539 100 µg

Human Syndecan-3 MAb (Clone 374420)

Sign In for Pricing
View Details
Raly-set siRNA/shRNA/RNAi Lentivector (Rat)
38467096 4x 500 ng

Raly-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rat Gsr (Glutathione reductase) ELISA Kit
ER0631 96 Tests

Rat Gsr (Glutathione reductase) ELISA Kit

Sign In for Pricing
View Details
Ghrelin Polyclonal Antibody
UB-GEN-15340 100 µL

Ghrelin Polyclonal Antibody

Sign In for Pricing
View Details