Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FOXB2 shRNA (UAS) - Lentiviral human FOXB2 shRNA (UAS) (100)
GTR15085098 1 Vial

Lentiviral human FOXB2 shRNA (UAS) - Lentiviral human FOXB2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Monoclonal Alpha Actinin 2 Antibody (ACTN2/3295) [Alexa Fluor 405]
NBP3-08788AF405 100 µL

Mouse Monoclonal Alpha Actinin 2 Antibody (ACTN2/3295) [Alexa Fluor 405]

Sign In for Pricing
View Details
Recombinant Human NME3 Protein, N-His
E55P2327 50 µg

Recombinant Human NME3 Protein, N-His

Sign In for Pricing
View Details
TRIM36, ID (TRIM36, RBCC728, RNF98, E3 ubiquitin-protein ligase TRIM36, RING finger protein 98, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728) (MaxLight 550) discontinued
043234-ML550 100 µL

TRIM36, ID (TRIM36, RBCC728, RNF98, E3 ubiquitin-protein ligase TRIM36, RING finger protein 98, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SERPINA11-set siRNA/shRNA/RNAi Lentivector (Human)
43438091 4x 500 ng

SERPINA11-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
STAT3 antibody
70R-37485 100 ug

STAT3 antibody

Sign In for Pricing
View Details