Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin S, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Product Specifications

Product Name Alternative

Cathepsin S Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-s-protein-mouse-hek293-his.html

Purity

96.92

Smiles

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIHHHHHH

Molecular Formula

13040 (Gene_ID) O70370 (V18-I340) (Accession)

Molecular Weight

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

References & Citations

[1]Richard D A Wilkinson, et al. Cathepsin S: therapeutic, diagnostic, and prognostic potential. Biol Chem. 2015 Aug;396 (8) :867-82.|[2]Brena F Sena, et al. Cathepsin S As an Inhibitor of Cardiovascular Inflammation and Calcification in Chronic Kidney Disease. Front Cardiovasc Med. 2018 Jan 5;4:88.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin 1 Recombinant Rabbit mAb
BS46931-01 50 µL

Angiopoietin 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Angiopoietin 1 Recombinant Rabbit mAb
BS46931-02 100 µL

Angiopoietin 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
GPR56/TM7LN4 Protein (C-His, Human)
P515579 100 µg

GPR56/TM7LN4 Protein (C-His, Human)

Sign In for Pricing
View Details
YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (MaxLight 750) discontinued
043957-ML750 100 µL

YIPF5, NT (YIPF5, FINGER5, YIP1A, Protein YIPF5, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5, Smooth muscle cell-associated protein 5, YIP1 family member 5, YPT-interacting protein 1 A) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CYP4A22 sgRNA CRISPR Lentivector (Human) (Target 3)
K0553404 1.0 µg DNA

CYP4A22 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Mouse KRT8 Protein, His (Fc)-Avi-tagged
KRT8-4941M 50 µg

Recombinant Mouse KRT8 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details