Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lentinula edodes Peroxidase (mnp2c)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Lentinula edodes mnp2c protein

Gene Name

Mnp2c

UniProt

B5U994

Expression Region

21-377aa

Organism

Lentinula edodes (Shiitake mushroom) (Lentinus edodes)

Target Sequence

APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.6 kDa

References & Citations

"Lemnp2, a manganese peroxidase from Lentinula edodes, is secreted into sawdust medium." Sakamoto Y., Nagai M., Nakade K., Sato T. Submitted (JUN-2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR559511 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
CD45RA (111-1C5), CF405S conjugate, 0.1mg/mL
BNC041038-500 1x 500 µL

CD45RA (111-1C5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GAP43 (Growth Associated Protein 43) CLIA Kit
E-CL-H1188-01 24 Tests

Human GAP43 (Growth Associated Protein 43) CLIA Kit

Sign In for Pricing
View Details
Human GAP43 (Growth Associated Protein 43) CLIA Kit
E-CL-H1188-02 48 Tests

Human GAP43 (Growth Associated Protein 43) CLIA Kit

Sign In for Pricing
View Details
Human GAP43 (Growth Associated Protein 43) CLIA Kit
E-CL-H1188-03 96 Tests

Human GAP43 (Growth Associated Protein 43) CLIA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560758 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details