Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Tumor necrosis factor (TNF), partial

Product Specifications

Product Name Alternative

Cachectin; TNF-alphaTumor necrosis factor ligand superfamily member 2 ; TNF-a

Abbreviation

Recombinant Bovine TNF protein, partial

Gene Name

TNF

UniProt

Q06599

Expression Region

78-234aa

Organism

Bos taurus (Bovine)

Target Sequence

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION

Molecular Weight

21.4 kDa

References & Citations

Cloning and characterization of the tandemly arranged bovine lymphotoxin and tumour necrosis factor-alpha genes.Cludts I., Cleuter Y., Kettmann R., Burny A., Droogmans L.Cytokine 5:336-341 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD223 (D-8) P
sc-514993 P 100 µg - 0.5 mL

CD223 (D-8) P

Sign In for Pricing
View Details
ORCTL-2 Antibody
DF3394-01 100 µL

ORCTL-2 Antibody

Sign In for Pricing
View Details
ORCTL-2 Antibody
DF3394-02 200 µL

ORCTL-2 Antibody

Sign In for Pricing
View Details
TrkA, ID (High Affinity Nerve Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 1, TRK1 Transforming Tyrosine Kinase Protein, p140-TrkA, Trk-A, NTRK1, TRK) (PE) discontinued
T8663-01H-PE 200 µL

TrkA, ID (High Affinity Nerve Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 1, TRK1 Transforming Tyrosine Kinase Protein, p140-TrkA, Trk-A, NTRK1, TRK) (PE) discontinued

Sign In for Pricing
View Details
ALK1 Antibody
orb844302 2 mg

ALK1 Antibody

Sign In for Pricing
View Details
Hexokinase-1 (HK1) Antibody
abx100801-01 100 µL

Hexokinase-1 (HK1) Antibody

Sign In for Pricing
View Details