Animal-Free beta-NGF, Human (His)
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Animal-Free Beta-NGF Protein, Human (His) is produced by E.coli (S122-A241), with C-terminal His-tag.This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free Beta-NGF Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-beta-ngf-protein-human-his.html
Purity
95.0
Smiles
MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Molecular Formula
4803 (Gene_ID) P01138 (S122-A241) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Lentiviral mouse B4galnt3 shRNA (UAS) - Lentiviral mouse B4galnt3 shRNA (UAS) (25)
Mouse Transforming Growth Factor Beta 3 (TGFB3) ELISA Kit
Mouse Transforming Growth Factor Beta 3 (TGFB3) ELISA Kit
Mouse Transforming Growth Factor Beta 3 (TGFB3) ELISA Kit
