Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronin-6/CORO6, Human (His)

Coronin-6/CORO6 Protein, Human (His) is the recombinant human-derived Coronin-6/CORO6 protein, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coronin-6/CORO6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/coronin-6-coro6-protein-human-his.html

Smiles

MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD

Molecular Formula

84940 (Gene_ID) Q6QEF8-4 (E255-D472) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Medroxy Progesterone-D3
TRC-M203552-1MG 1 mg

Medroxy Progesterone-D3

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker), CF568 conjugate, 0.1mg/mL
BNC681685-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ERGIC2 activation kit by CRISPRa
GA109709 1 Kit

Human ERGIC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Calpain 12 (CAPN12) activation kit by CRISPRa
GA115645 1 Kit

Human Calpain 12 (CAPN12) activation kit by CRISPRa

Sign In for Pricing
View Details
TTC22 (NM_001114108) Human Over-expression Lysate
LC426454 20 µg

TTC22 (NM_001114108) Human Over-expression Lysate

Sign In for Pricing
View Details
TSHZ3 antibody
FNab09046 100 µg

TSHZ3 antibody

Sign In for Pricing
View Details