Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement factor I (CFI), partial

Product Specifications

Product Name Alternative

(C3B/C4B inactivator)

Abbreviation

Recombinant Human CFI protein, partial

Gene Name

CFI

UniProt

P05156

Expression Region

239-316aa

Organism

Homo sapiens (Human)

Target Sequence

KACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERR

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Trypsin-like serine protease that plays an essential role in regulating the immune response by controlling all complement pathways. Inhibits these pathways by cleaving three peptide bonds in the alpha-chain of C3b and two bonds in the alpha-chain of C4b thereby inactivating these proteins . Essential cofactors for these reactions include factor H and C4BP in the fluid phase and membrane cofactor protein/CD46 and CR1 on cell surfaces . The presence of these cofactors on healthy cells allows degradation of deposited C3b by CFI in order to prevent undesired complement activation, while in apoptotic cells or microbes, the absence of such cofactors leads to C3b-mediated complement activation and subsequent opsonization .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.4 kDa

References & Citations

"Regulator-dependent mechanisms of C3b processing by factor I allow differentiation of immune responses." Xue X., Wu J., Ricklin D., Forneris F., Di Crescenzio P., Schmidt C.Q., Granneman J., Sharp T.H., Lambris J.D., Gros P. Nat. Struct. Mol. Biol. 24:643-651 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNRHR2 Antibody
MBS9418354-01 0.05 mL

GNRHR2 Antibody

Sign In for Pricing
View Details
GNRHR2 Antibody
MBS9418354-02 0.1 mL

GNRHR2 Antibody

Sign In for Pricing
View Details
GNRHR2 Antibody
MBS9418354-03 5x 0.1 mL

GNRHR2 Antibody

Sign In for Pricing
View Details
Diclofenac acid
abx183982-01 5 g

Diclofenac acid

Sign In for Pricing
View Details
Diclofenac acid
abx183982-02 25 g

Diclofenac acid

Sign In for Pricing
View Details
Rat DNA damage-inducible transcript 3 protein, DDIT3; CHOP ELISA KIT
E1509Ra-01 48 Well

Rat DNA damage-inducible transcript 3 protein, DDIT3; CHOP ELISA KIT

Sign In for Pricing
View Details