Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT4A1, Human

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS) .SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SULT4A1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult4a1-protein-human.html

Purity

96.00

Smiles

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Molecular Formula

25830 (Gene_ID) Q9BR01 (M1-L284) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp426 (NM_001079943) Rat Untagged Clone
RN204867 10 µg

Zfp426 (NM_001079943) Rat Untagged Clone

Sign In for Pricing
View Details
CHRFAM7A Human Gene Knockout Kit (CRISPR)
KN207623BN 1 Kit

CHRFAM7A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTK2B Antibody (C-term) [AMR09636G]
AMR09636G-01 50 µL

PTK2B Antibody (C-term) [AMR09636G]

Sign In for Pricing
View Details
PTK2B Antibody (C-term) [AMR09636G]
AMR09636G-02 100 µL

PTK2B Antibody (C-term) [AMR09636G]

Sign In for Pricing
View Details
PTK2B Antibody (C-term) [AMR09636G]
AMR09636G-03 200 µL

PTK2B Antibody (C-term) [AMR09636G]

Sign In for Pricing
View Details
PTK2B Antibody (C-term) [AMR09636G]
AMR09636G-04 400 µL

PTK2B Antibody (C-term) [AMR09636G]

Sign In for Pricing
View Details