Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT4A1, Human

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS) .SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SULT4A1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult4a1-protein-human.html

Purity

96.00

Smiles

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Molecular Formula

25830 (Gene_ID) Q9BR01 (M1-L284) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (Biotin)
MBS6143077-01 0.1 mL

MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (Biotin)

Ask
View Details
MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (Biotin)
MBS6143077-02 5x 0.1 mL

MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (Biotin)

Ask
View Details
PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (PE) discontinued
040165-PE 200 µL

PLEKHO2, NT (PLEKHO2, PLEKHQ1, Pleckstrin homology domain-containing family O member 2, Pleckstrin homology domain-containing family Q member 1) (PE) discontinued

Ask
View Details
Ttc3 (NM_009441) Mouse Tagged ORF Clone
MR219961 10 µg

Ttc3 (NM_009441) Mouse Tagged ORF Clone

Ask
View Details
RECQL4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38783126 3x 1.0µg DNA

RECQL4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details
Lentiviral human CCDC34 sgRNA gene knockout kit - Lentiviral human CCDC34 sgRNA gene knockout kit (plasmid)
GTR15392483 1 Vial

Lentiviral human CCDC34 sgRNA gene knockout kit - Lentiviral human CCDC34 sgRNA gene knockout kit (plasmid)

Ask
View Details