Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT4A1, Human

SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS) .SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SULT4A1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult4a1-protein-human.html

Purity

96.00

Smiles

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

Molecular Formula

25830 (Gene_ID) Q9BR01 (M1-L284) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSK1 (Phospho Ser376) Polyclonal Antibody
BT-AP11545-01 20 µL

MSK1 (Phospho Ser376) Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (Phospho Ser376) Polyclonal Antibody
BT-AP11545-02 50 µL

MSK1 (Phospho Ser376) Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (Phospho Ser376) Polyclonal Antibody
BT-AP11545-03 100 µL

MSK1 (Phospho Ser376) Polyclonal Antibody

Sign In for Pricing
View Details
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (AP)
MBS6164129-01 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (AP)

Sign In for Pricing
View Details
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (AP)
MBS6164129-02 5x 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (AP)

Sign In for Pricing
View Details
Lipoxygenase, Pseudomonas aeruginosa (FLAG, His)
HY-P702171 1 Each

Lipoxygenase, Pseudomonas aeruginosa (FLAG, His)

Sign In for Pricing
View Details