SULT4A1, Human
SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS) .SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.
Product Specifications
Product Name Alternative
SULT4A1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sult4a1-protein-human.html
Purity
96.00
Smiles
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Molecular Formula
25830 (Gene_ID) Q9BR01 (M1-L284) (Accession)
Molecular Weight
Approximately 34.0 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740096-100 1x 100 µL
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details