Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPAR, Human (GST)

The uPAR protein is a receptor for urokinase plasminogen activator and actively localizes and promotes plasmin formation. It mediates proteolysis-independent signaling activated by U-PA and undergoes negative feedback regulation. uPAR Protein, Human (GST) is the recombinant human-derived uPAR protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

UPAR Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/upar-protein-human-gst.html

Purity

90.00

Smiles

LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG

Molecular Formula

5329 (Gene_ID) Q03405-1 (L23-G305) (Accession)

Molecular Weight

58.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MUC4 Antibody Picoband® (Biotine Conjugate)
PB9147-Biotin 100 µg/Vial

Anti-MUC4 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Lgi4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7234708 1.0 µg DNA

Lgi4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Anti-Rat Fibulin 1 (FBLN1) Monoclonal Antibody
VD4N262 1 Each

Mouse Anti-Rat Fibulin 1 (FBLN1) Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody [DyLight 680]
NBP2-81758FR 0.1 mL

Rabbit Polyclonal N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody [DyLight 680]

Sign In for Pricing
View Details
POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (MaxLight 490)
207848-ML490 100 µL

POLR1C (Polymerase (RNA) I Polypeptide C, 30kD, OTTHUMP00000016470, RNA Polymerase I Subunit, RPA39, RPA40, RPA5, RPAC1) (MaxLight 490)

Sign In for Pricing
View Details
Bovine Chromosome associated kinesin KIF4B (KIF4B) ELISA kit
GTR10427510 96 Well

Bovine Chromosome associated kinesin KIF4B (KIF4B) ELISA kit

Sign In for Pricing
View Details