Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human Ace2 (N-Terminal) Polyclonal Antibody
CPBT-67738RH 0.1 mg

Rabbit Anti Human Ace2 (N-Terminal) Polyclonal Antibody

Sign In for Pricing
View Details
RALB siRNA (Human)
MBS8232000-01 15 nmol

RALB siRNA (Human)

Sign In for Pricing
View Details
RALB siRNA (Human)
MBS8232000-02 30 nmol

RALB siRNA (Human)

Sign In for Pricing
View Details
RALB siRNA (Human)
MBS8232000-03 5x 30 nmol

RALB siRNA (Human)

Sign In for Pricing
View Details
Pyridoxal-5 -Phosphate 99.0%
199425-01 1 g

Pyridoxal-5 -Phosphate 99.0%

Sign In for Pricing
View Details
Pyridoxal-5 -Phosphate 99.0%
199425-02 5 g

Pyridoxal-5 -Phosphate 99.0%

Sign In for Pricing
View Details