Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SGMS2 siRNA
abx904899-01 15 nmol

Human SGMS2 siRNA

Sign In for Pricing
View Details
Human SGMS2 siRNA
abx904899-02 30 nmol

Human SGMS2 siRNA

Sign In for Pricing
View Details
Glycolipid autoantibody Human ELISA Kit
D7721 96 Tests

Glycolipid autoantibody Human ELISA Kit

Sign In for Pricing
View Details
Human MED4 Pre-designed siRNA Set A
SI009427A 1 Each

Human MED4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZNF131 Protein Vector (Human) (pPM-C-HA)
PV047359 500 ng

ZNF131 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rad18 Polyclonal Antibody
ABP52305-01 30 µL

Rad18 Polyclonal Antibody

Sign In for Pricing
View Details