Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-1912-3p antagomir
HY-RI00368A-01 5 nmol

Hsa-miR-1912-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-1912-3p antagomir
HY-RI00368A-02 20 nmol

Hsa-miR-1912-3p antagomir

Sign In for Pricing
View Details
TAPBPL Lentiviral Activation Particles (h)
sc-409990-LAC 200 µL

TAPBPL Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
CATSPERB (NM_024764) Human Untagged Clone
SC305149 10 µg

CATSPERB (NM_024764) Human Untagged Clone

Sign In for Pricing
View Details
T4 DNA Ligase (High Conc.)
MBS9141678-01 80 K Units

T4 DNA Ligase (High Conc.)

Sign In for Pricing
View Details
T4 DNA Ligase (High Conc.)
MBS9141678-02 400 K Units

T4 DNA Ligase (High Conc.)

Sign In for Pricing
View Details