Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1A1 Rabbit Polyclonal Antibody
TA360257 100 µL

OR1A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PHF10 Protein - (Dry Ice)
H00055274-P02-25ug 25 µg

Recombinant Human PHF10 Protein - (Dry Ice)

Sign In for Pricing
View Details
Anti-PAN2 antibody
STJ117568 100 µl

Anti-PAN2 antibody

Sign In for Pricing
View Details
Human SASH3 Pre-designed siRNA Set B
SI014289B 1 Each

Human SASH3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human CPA4 Protein, N-His
HV993012-01 50 µg

Recombinant Human CPA4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CPA4 Protein, N-His
HV993012-02 100 µg

Recombinant Human CPA4 Protein, N-His

Sign In for Pricing
View Details