Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-human VEGF mAb (6C)
A09D12-6C 1 Each

Mouse anti-human VEGF mAb (6C)

Sign In for Pricing
View Details
alpha-Taxilin Overexpression Lysate (Native) - (Dry Ice)
NBP2-05052 0.1 mg

alpha-Taxilin Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Mouse Monoclonal IL-17B Antibody (MM0373-3D62) [mFluor Violet 610 SE]
NBP2-11672MFV610 0.1 mL

Mouse Monoclonal IL-17B Antibody (MM0373-3D62) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
RPL23AP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1939608 1.0 µg DNA

RPL23AP12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLPI Human Gene Knockout Kit (CRISPR)
KN404697 1 Kit

SLPI Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant human LGALS3BP protein with C-terminal human Fc tag
32-17207-50 50 µg

Recombinant human LGALS3BP protein with C-terminal human Fc tag

Sign In for Pricing
View Details