Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp4f40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3069107 1.0 µg DNA

Cyp4f40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WIF1 Rabbit Polyclonal Antibody
TA383320 100 µL

WIF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Decorin (DCN) Antibody
abx432598 200 µL

Decorin (DCN) Antibody

Sign In for Pricing
View Details
Nevanimibe hydrochloride 100mg
A21767-100 100 mg

Nevanimibe hydrochloride 100mg

Sign In for Pricing
View Details
MIR6910 Mouse qPCR Template Standard (MI0022757)
MK300893 200 Reactions

MIR6910 Mouse qPCR Template Standard (MI0022757)

Sign In for Pricing
View Details
Phospho-TBK1 (Ser172) Recombinant Antibody, APC Conjugated
bsm-60659R-APC-01 20 µL

Phospho-TBK1 (Ser172) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details