Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 (SRY (Sex Determining Region Y) -Box 9, CMD1, CMPD1, SRA1) (Biotin)
251987-Biotin 100 µL

SOX9 (SRY (Sex Determining Region Y) -Box 9, CMD1, CMPD1, SRA1) (Biotin)

Sign In for Pricing
View Details
PHAPI2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6769R-BF555 100 µL

PHAPI2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GNA11 Protein Vector (Human) (pPM-C-HA)
PV017931 500 ng

GNA11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
C6orf48 (NM_001040438) Human Tagged Lenti ORF Clone
RC203286L4 10 µg

C6orf48 (NM_001040438) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
3- (2,4-Dimethyl-1H-imidazol-1-yl) -5- (trifluoromethyl) aniline
422548-01 100 mg

3- (2,4-Dimethyl-1H-imidazol-1-yl) -5- (trifluoromethyl) aniline

Sign In for Pricing
View Details
3- (2,4-Dimethyl-1H-imidazol-1-yl) -5- (trifluoromethyl) aniline
422548-02 500 mg

3- (2,4-Dimethyl-1H-imidazol-1-yl) -5- (trifluoromethyl) aniline

Sign In for Pricing
View Details