Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)

CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.

Product Specifications

Product Name Alternative

CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html

Smiles

FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

Molecular Formula

943 (Gene_ID) P28908 (F19-K379) (Accession)

Molecular Weight

Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCF3 Antibody
A60053-100UL 100 µL

ABCF3 Antibody

Sign In for Pricing
View Details
PON1 Activator (ZNPA, (Z) -2,3-bis (4-nitrophenyl) -acrylonitrile)
217682 10 mg

PON1 Activator (ZNPA, (Z) -2,3-bis (4-nitrophenyl) -acrylonitrile)

Sign In for Pricing
View Details
Sec31b Mouse shRNA Lentiviral Particle (Locus ID 240667)
TL517555V 500 µL Each

Sec31b Mouse shRNA Lentiviral Particle (Locus ID 240667)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)
MBS1039457-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)
MBS1039457-02 0.1 mg (E-Coli)

Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)
MBS1039457-03 0.02 mg (Yeast)

Recombinant Salmonella heidelberg S-ribosylhomocysteine lyase (luxS)

Sign In for Pricing
View Details