CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.
Product Specifications
Product Name Alternative
CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html
Smiles
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Molecular Formula
943 (Gene_ID) P28908 (F19-K379) (Accession)
Molecular Weight
Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal MRPL13 Antibody (OTI6A11) [Alexa Fluor 750]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
NBP2-72780AF750 0.1 mL
Mouse Monoclonal MRPL13 Antibody (OTI6A11) [Alexa Fluor 750]
Sign In for Pricing
View Details 
bsm-52594R-PE-Cy7-01 20 µL
AGR2 Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details bsm-52594R-PE-Cy7-02 100 µL
AGR2 Recombinant Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details ![EPPS (HEPPS) [N- (2-Hydroxyethyl) piperazine-N'-3-propanesulfonic acid] 99.0% Cell Culture Tested](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
TC1063-01 25 g
EPPS (HEPPS) [N- (2-Hydroxyethyl) piperazine-N'-3-propanesulfonic acid] 99.0% Cell Culture Tested
Sign In for Pricing
View Details TC1063-02 25 g
EPPS (HEPPS) [N- (2-Hydroxyethyl) piperazine-N'-3-propanesulfonic acid] 99.0% Cell Culture Tested
Sign In for Pricing
View Details