CD30/TNFRSF8, Human (Biotinylated, HEK293, His-Avi)
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His, C-Avi labeled tag.
Product Specifications
Product Name Alternative
CD30/TNFRSF8 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his-avi.html
Smiles
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Molecular Formula
943 (Gene_ID) P28908 (F19-K379) (Accession)
Molecular Weight
Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1949202 1.0 µg DNA
RPL26P6 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
TL307133V 500 µL Each
MESP1 Human shRNA Lentiviral Particle (Locus ID 55897)
Sign In for Pricing
View Details 
MBS9357434-01 48 Well
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
Sign In for Pricing
View Details MBS9357434-02 96 Well
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
Sign In for Pricing
View Details