Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mLT5 (TESMIN) (NM_004923) Human 3' UTR Clone
SC210613 10 µg

mLT5 (TESMIN) (NM_004923) Human 3' UTR Clone

Sign In for Pricing
View Details
COL6A1, NT (Collagen alpha-1 (VI) Chain) (MaxLight 650) discontinued
C7510-61Y-ML650 100 µL

COL6A1, NT (Collagen alpha-1 (VI) Chain) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001114136) Human Over-expression Lysate
LC426464 20 µg

Dematin (DMTN) (NM_001114136) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD115/CSF1R Protein, C-His
E55P0813 50 µg

Recombinant Human CD115/CSF1R Protein, C-His

Sign In for Pricing
View Details
RNLS (Renalase, Monoamine Oxidase-C, MAO-C, C10orf59, FLJ11218) (MaxLight 405) discontinued
124062-ML405 100 µL

RNLS (Renalase, Monoamine Oxidase-C, MAO-C, C10orf59, FLJ11218) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ZNF22-AS1 Human siRNA Oligo Duplex (Locus ID 220979)
SR316575 1 Kit

ZNF22-AS1 Human siRNA Oligo Duplex (Locus ID 220979)

Sign In for Pricing
View Details