Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMOD2 Protein Vector (Rat) (pPM-C-HA)
PV277824 500 ng

LMOD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MRX40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1342707 1.0 µg DNA

MRX40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Research Grade Anti-Human IL11RA Antibody (X209)
DHG84901 100 μg

Research Grade Anti-Human IL11RA Antibody (X209)

Sign In for Pricing
View Details
ZNF229, NT (ZNF229, Zinc finger protein 229)
044160 200 µL

ZNF229, NT (ZNF229, Zinc finger protein 229)

Sign In for Pricing
View Details
U2AF65 (U2AF2) (NM_001012478) Human Untagged Clone
SC301664 10 µg

U2AF65 (U2AF2) (NM_001012478) Human Untagged Clone

Sign In for Pricing
View Details
PRIMA1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37618151 3x 1.0 µg DNA

PRIMA1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details