Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-POLR2A (S2) Rabbit monoclonal antibody
BS40518-01 50 µL

Phospho-POLR2A (S2) Rabbit monoclonal antibody

Sign In for Pricing
View Details
Phospho-POLR2A (S2) Rabbit monoclonal antibody
BS40518-02 100 µL

Phospho-POLR2A (S2) Rabbit monoclonal antibody

Sign In for Pricing
View Details
Human Nucleolin ELISA Kit (NCL)
RK01922 96 Tests

Human Nucleolin ELISA Kit (NCL)

Sign In for Pricing
View Details
LOC100041362 3'UTR GFP Stable Cell Line
TU161279 1.0 mL

LOC100041362 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FBXO33 Recombinant Protein (Rat)
RP201023 100 µg

FBXO33 Recombinant Protein (Rat)

Sign In for Pricing
View Details
APC/Cyanine7 anti-mouse CD8a
GT00278 100 µg

APC/Cyanine7 anti-mouse CD8a

Sign In for Pricing
View Details