Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CuL4b (NM_001106951) Rat Tagged Lenti ORF Clone
RR209256L3 10 µg

CuL4b (NM_001106951) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfactory receptor 10C1 Polyclonal Antibody
RA28032-01 50 µL

Olfactory receptor 10C1 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 10C1 Polyclonal Antibody
RA28032-02 100 µL

Olfactory receptor 10C1 Polyclonal Antibody

Sign In for Pricing
View Details
USP51 (NM_201286) Human Tagged ORF Clone
RC214303 10 µg

USP51 (NM_201286) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human IgG4 Fc plus hinge region
ICH2268-50mg 50 mg

Human IgG4 Fc plus hinge region

Sign In for Pricing
View Details
Podocin (PDCN)
141926 200 µL

Podocin (PDCN)

Sign In for Pricing
View Details