Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Tagged ORF Clone Lentiviral Particle
RC202433L4V 200 µL

Leukotriene B4 Receptor (LTB4R) (NM_181657) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human FSIP1 (Fibrous Sheath Interacting Protein 1) ELISA Kit
EH24629 96 Tests

Human FSIP1 (Fibrous Sheath Interacting Protein 1) ELISA Kit

Sign In for Pricing
View Details
Ankrd33b (NM_027496) Mouse Tagged ORF Clone
MG218341 10 µg

Ankrd33b (NM_027496) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bacteria lysis kit
604BK-50 50 Isolations

Bacteria lysis kit

Sign In for Pricing
View Details
Lentiviral mouse Gper1 shRNA (UAS) - Lentiviral mouse Gper1 shRNA (UAS, iRFP) plasmid
GTR15141388 1 Vial

Lentiviral mouse Gper1 shRNA (UAS) - Lentiviral mouse Gper1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MAP3K8 Human shRNA Plasmid Kit (Locus ID 1326)
TL320308 1 Kit

MAP3K8 Human shRNA Plasmid Kit (Locus ID 1326)

Sign In for Pricing
View Details