Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC22A15 shRNA (UAS) - Lentiviral human SLC22A15 shRNA (UAS) (100)
GTR15333441 1 Vial

Lentiviral human SLC22A15 shRNA (UAS) - Lentiviral human SLC22A15 shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Monoclonal NRAS Antibody (OTI5G7) [Dylight 594]
NBP2-73053DL594 0.1 mL

Mouse Monoclonal NRAS Antibody (OTI5G7) [Dylight 594]

Sign In for Pricing
View Details
Lentiviral human PPM1K sgRNA gene knockout kit - Lentiviral human PPM1K sgRNA gene knockout kit (plasmid)
GTR15369674 1 Vial

Lentiviral human PPM1K sgRNA gene knockout kit - Lentiviral human PPM1K sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Sodium chloride p.A.
LC-5932.4 500 g

Sodium chloride p.A.

Sign In for Pricing
View Details
CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Biotin)
367090 100 µg

CD4 (CD4 Antigen, CD4 Molecule, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Biotin)

Sign In for Pricing
View Details
Human beta-Lipotropic Hormone (beta-LPH) ELISA Kit
MBS268986-01 48 Well

Human beta-Lipotropic Hormone (beta-LPH) ELISA Kit

Sign In for Pricing
View Details