Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1E1, Human (N-His)

The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SULT1E1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sult1e1-protein-human-n-his.html

Purity

97.00

Smiles

NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

Molecular Formula

6783 (Gene_ID) P49888 (N2-I294) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

M7 (3'AcmG) (5') ppp (5') (2'OMeA) pG ammonium
HY-164192 1 Each

M7 (3'AcmG) (5') ppp (5') (2'OMeA) pG ammonium

Sign In for Pricing
View Details
Eotaxin (CCL11) (NM_002986) Human Recombinant Protein
TP720904XL 1 mg

Eotaxin (CCL11) (NM_002986) Human Recombinant Protein

Sign In for Pricing
View Details
Human DLX6 Knockout HEK293T cell line
GTR15412679 1 Vial

Human DLX6 Knockout HEK293T cell line

Sign In for Pricing
View Details
ENDOGL1 Rabbit Monoclonal Antibody
AMRe01453-01 1 Each

ENDOGL1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ENDOGL1 Rabbit Monoclonal Antibody
AMRe01453-02 50 µL

ENDOGL1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ENDOGL1 Rabbit Monoclonal Antibody
AMRe01453-03 100 µL

ENDOGL1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details