Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Spondin-2/SPON2, Human (Q9BUD6, HEK293, His)

Spondin-2/SPON2 protein, as a cell adhesion molecule, plays a key role in promoting the adhesion and growth of hippocampal embryonic neurons.In addition to its role in neurodevelopment, SPON2 acts as a direct binder of bacteria and their components, functioning as an opsonin to promote phagocytosis of bacteria by macrophages.Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His) is the recombinant human-derived Spondin-2/SPON2 protein, expressed by HEK293 , with His labeled tag.

Product Specifications

Product Name Alternative

Spondin-2/SPON2 Protein, Human (Q9BUD6, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spondin-2-spon2-protein-human-q9bud6-hek293-his.html

Purity

96.00

Smiles

QPLGGESICSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

Molecular Formula

10417 (Gene_ID) Q9BUD6 (Q27-V331) (Accession)

Molecular Weight

Approximately 40-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl 2,3-anhydro-β-D-ribopyranoside
GC7844-100mg 100 mg

Benzyl 2,3-anhydro-β-D-ribopyranoside

Sign In for Pricing
View Details
Abiraterone Impurity 20
RM-A021820-01 10 mg

Abiraterone Impurity 20

Sign In for Pricing
View Details
Abiraterone Impurity 20
RM-A021820-02 25 mg

Abiraterone Impurity 20

Sign In for Pricing
View Details
Abiraterone Impurity 20
RM-A021820-03 50 mg

Abiraterone Impurity 20

Sign In for Pricing
View Details
Abiraterone Impurity 20
RM-A021820-04 100 mg

Abiraterone Impurity 20

Sign In for Pricing
View Details
Dog Intercellular Adhesion Molecule 1 (ICAM1) ELISA Kit
MBS2701983-01 24 Strip Well

Dog Intercellular Adhesion Molecule 1 (ICAM1) ELISA Kit

Sign In for Pricing
View Details