Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-2R alpha/CD25, Mouse (HEK293, His)

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2].IL-2R alpha/CD25 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells.

Product Specifications

Product Name Alternative

IL-2R alpha/CD25 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-2r-alpha-cd25-protein-mouse-215a-a-hek293-his.html

Purity

95.00

Smiles

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Molecular Formula

16184 (Gene_ID) P01590/NP_032393.3 (E22-K236) (Accession)

Molecular Weight

40-60 kDa

References & Citations

[1]H.Asao. Interleukin-2. Reference Module in Biomedical Sciences. 2014. ISBN 9780128012383.|[2]Kim HP, et al. The basis for IL-2-induced IL-2 receptor alpha chain gene regulation: importance of two widely separated IL-2 response elements. Immunity. 2001 Jul;15 (1) :159-72.|[3]Bell CJ, et al. Sustained in vivo signaling by long-lived IL-2 induces prolonged increases of regulatory T cells. J Autoimmun. 2015 Jan;56:66-80.|[4]Chistiakov DA, et al. The crucial role of IL-2/IL-2RA-mediated immune regulation in the pathogenesis of type 1 diabetes, an evidence coming from genetic and animal model studies. Immunol Lett. 2008 Jun 15;118 (1) :1-5.|[5]Xie JH, et al. Mouse IL-2/CD25 Fusion Protein Induces Regulatory T Cell Expansion and Immune Suppression in Preclinical Models of Systemic Lupus Erythematosus. J Immunol. 2021 Jul 1;207 (1) :34-43.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nerve Growth Factor, beta, 2.5S, 7S (NGF) (Biotin) discontinued
N2050-06C-Biotin 100 µL

Nerve Growth Factor, beta, 2.5S, 7S (NGF) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Endoglycan/PODXL2 Antibody (211816) [DyLight 650]
FAB1524W 0.1 mL

Mouse Monoclonal Endoglycan/PODXL2 Antibody (211816) [DyLight 650]

Sign In for Pricing
View Details
STAT4 Antibody, Biotin conjugated
A35792-50UG 50 µg

STAT4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
EPB41 Human shRNA Lentiviral Particle (Locus ID 2035)
TL313196V 500 µL Each

EPB41 Human shRNA Lentiviral Particle (Locus ID 2035)

Sign In for Pricing
View Details
Mouse Xlr3a ELISA KIT
ELI-28771m 96 Tests

Mouse Xlr3a ELISA KIT

Sign In for Pricing
View Details
Clostridium difficile Toxin A Antibody
abx021626 1 mg

Clostridium difficile Toxin A Antibody

Sign In for Pricing
View Details