I-TAC/CXCL11, Human (HEK293)
CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), belongs to the ELR-negative CXC chemokine family. CXCL11 is produced by a variety of cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs) . CXCL11 signals through CXCR3. CXCL11 is associated with pleiotropic functions including chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects[1][2]. I-TAC/CXCL11 Protein, Human (HEK293) consists of 73 amino acids (F22-F94) and is expressed in HEK293 cells.
Product Specifications
Product Name Alternative
I-TAC/CXCL11 Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/i-tac-cxcl11-protein-human-hek293.html
Purity
98.0
Smiles
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Molecular Formula
6373 (Gene_ID) O14625 (F22-F94) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
