Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Double-headed protease inhibitor, submandibular gland

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Dog Double-headed protease inhibitor, submandibular gland protein

UniProt

P01002

Expression Region

1-115aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

GPPPAIGREVDCSNYKGKGSQIACPRLHQPICGTDHKTYSNECMFCALTLNKKFEVRKLQDTACDIECTEYSDMCTMDYRPLCGSDGKNYSNKCSFCNAVKKSRGTIFLAKHGEC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp2r3d Mouse shRNA Lentiviral Particle (Locus ID 19054)
TL517609V 500 µL Each

Ppp2r3d Mouse shRNA Lentiviral Particle (Locus ID 19054)

Sign In for Pricing
View Details
TULP3 antibody
10R-7229 100 ul

TULP3 antibody

Sign In for Pricing
View Details
MAGEA9 (MAGEA9B) CytoSection
TS415411P5 25 Slides

MAGEA9 (MAGEA9B) CytoSection

Sign In for Pricing
View Details
Recombinant Mouse CSTF2T Protein, His (Fc)-Avi-tagged
CSTF2T-2039M 50 µg

Recombinant Mouse CSTF2T Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
BICD1 Protein Vector (Mouse) (pPM-C-His)
PV159425 500 ng

BICD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal Nav1.7 Antibody (5A11)
H00006335-M01 0.1 mg

Mouse Monoclonal Nav1.7 Antibody (5A11)

Sign In for Pricing
View Details