Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPO/Thrombopoietin, Human (CHO, His, solution)

TPO/Thrombopoietin Protein, Human (CHO, His, solution), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.

Product Specifications

Product Name Alternative

TPO/Thrombopoietin Protein, Human (CHO, His, solution), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tpo-protein-human-cho.html

Purity

97.00

Smiles

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Formula

7066 (Gene_ID) P40225-1 (S22-G353) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Kuter DJ, et al. Thrombopoietin: Biology and Clinical Applications. Oncologist. 1996;1 (1 & 2) :98-106.|[2]Hitchcock IS, et al. Thrombopoietin from beginning to end. Br J Haematol. 2014 Apr;165 (2) :259-68.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT140 (NM_014714) Human Tagged ORF Clone Lentiviral Particle
RC207528L1V 200 µL

IFT140 (NM_014714) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human NEDD8
PKSH034041-01 10 µg

Recombinant Human NEDD8

Sign In for Pricing
View Details
Recombinant Human NEDD8
PKSH034041-02 50 µg

Recombinant Human NEDD8

Sign In for Pricing
View Details
UBAP1 Antibody
A73956-50UL 50 μL

UBAP1 Antibody

Sign In for Pricing
View Details
HDAC1 HDR Plasmid (h)
sc-400203-HDR 20 µg

HDAC1 HDR Plasmid (h)

Sign In for Pricing
View Details
VMN2R96 Adenovirus (Mouse)
49843054 1.0 mL

VMN2R96 Adenovirus (Mouse)

Sign In for Pricing
View Details