TPO/Thrombopoietin, Human (CHO, His, solution)
Selected Variant
HY-P7115-01
Size: 2 µg
TPO/Thrombopoietin Protein, Human (CHO, His, solution), also called megakaryocyte growth and development factor, is a cytokine that regulates megakaryocyte and platelet production.
Product Specifications
Product Name Alternative
TPO/Thrombopoietin Protein, Human (CHO, His, solution), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tpo-protein-human-cho.html
Purity
97.00
Smiles
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Molecular Formula
7066 (Gene_ID) P40225-1 (S22-G353) (Accession)
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Kuter DJ, et al. Thrombopoietin: Biology and Clinical Applications. Oncologist. 1996;1 (1 & 2) :98-106.|[2]Hitchcock IS, et al. Thrombopoietin from beginning to end. Br J Haematol. 2014 Apr;165 (2) :259-68.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042567-100 1x 100 µL
Growth Hormone (Pituitary Marker) (rGH/1450), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472156-100 1x 100 µL
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742947-100 1x 100 µL
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/2947R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
EK2100-carrier-free 96 Well With Removable Strips
Rat Legumain ELISA Kit PicoKine®, Carrier-free
Sign In for Pricing
View Details 
BNUB3603-100 1x 100 µL
Retinol Binding Protein-1 (RBP1) (rRBP1/872), 0.2mg/mL
Sign In for Pricing
View Details 
A11137-1-Cy3 100 µg/Vial
Anti-cPLA2 beta/PLA2G4B Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details