Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Erythropoietin receptor (Epor), partial

Product Specifications

Product Name Alternative

EPO-R

Abbreviation

Recombinant Mouse Epor protein, partial

Gene Name

Epor

UniProt

P14753

Expression Region

25-249aa

Organism

Mus musculus (Mouse)

Target Sequence

APSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.3 kDa

References & Citations

"Saturation mutagenesis of the WSXWS motif of the erythropoietin receptor." Hilton D.J., Watowich S.S., Katz L., Lodish H.F. J. Biol. Chem. 271:4699-4708 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (B-Cell Marker) (N/A), CF568 conjugate, 0.1mg/mL
BNC681794-500 1x 500 µL

CD45RB (B-Cell Marker) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
St3gal3 Mouse Gene Knockout Kit (CRISPR)
KN516798 1 Kit

St3gal3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA Kit
RDR-EMILIN2-Hu-01 96 Tests

Human Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA Kit

Sign In for Pricing
View Details
Human Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA Kit
RDR-EMILIN2-Hu-02 48 Tests

Human Elastin Microfibril Interface Located Protein 2 (EMILIN2) ELISA Kit

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA503608BM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
ASB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C2]
TA808166AM 100 µL

ASB2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C2]

Sign In for Pricing
View Details