What is the catalog number for IL-3, Mouse?

The catalog number for IL-3, Mouse is HY-P7062.

What sizes are available for IL-3, Mouse?

IL-3, Mouse is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 250 µg, 500 µg.

How many pack sizes does IL-3, Mouse come in?

IL-3, Mouse is available in 6 different pack sizes.

Is IL-3, Mouse in stock?

IL-3, Mouse is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures IL-3, Mouse?

IL-3, Mouse is manufactured by QuantiMol.

What is the estimated delivery time for IL-3, Mouse?

Estimated delivery time for IL-3, Mouse is approximately 15 business day(s), depending on your location.

IL-3, Mouse

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Immunology/Inflammation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse.html

Purity

98.0

Smiles

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (D33-C166) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.