Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Immunology/Inflammation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse.html

Purity

98.0

Smiles

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (D33-C166) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP1 Antibody
43-642 0.1 mg

BMP1 Antibody

Sign In for Pricing
View Details
SOX4, Antibody
GWB-600755 1 mL

SOX4, Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RGL4 Antibody [PerCP]
NBP3-05804PCP 0.1 mL

Rabbit Polyclonal RGL4 Antibody [PerCP]

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8215957-01 1 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8215957-02 5 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details
Caspase 6 Blocking Peptide
MBS8215957-03 5x 5 mg

Caspase 6 Blocking Peptide

Sign In for Pricing
View Details