Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Mouse

IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Product Specifications

Product Name Alternative

IL-3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Related Pathways

Immunology/Inflammation

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-mouse.html

Purity

98.0

Smiles

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Formula

16187 (Gene_ID) P01586 (D33-C166) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3 siRNA (Human)
orb1864094-01 15 nmol

RPS3 siRNA (Human)

Sign In for Pricing
View Details
RPS3 siRNA (Human)
orb1864094-02 30 nmol

RPS3 siRNA (Human)

Sign In for Pricing
View Details
Tec, ID (Tec, Tyrosine-protein kinase Tec) (MaxLight 405)
MBS6354705-01 0.1 mL

Tec, ID (Tec, Tyrosine-protein kinase Tec) (MaxLight 405)

Sign In for Pricing
View Details
Tec, ID (Tec, Tyrosine-protein kinase Tec) (MaxLight 405)
MBS6354705-02 5x 0.1 mL

Tec, ID (Tec, Tyrosine-protein kinase Tec) (MaxLight 405)

Sign In for Pricing
View Details
GCAP1 (GUCA1A) CytoSection
TS406595P5 25 Slides

GCAP1 (GUCA1A) CytoSection

Sign In for Pricing
View Details
Mouse Ovalbumin Specific IgE (OVA-sIgE) ELISA Kit
JL55065-01 48 Tests

Mouse Ovalbumin Specific IgE (OVA-sIgE) ELISA Kit

Sign In for Pricing
View Details